Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial HRP1 protein

This Bacterial HRP1 protein spans the amino acid sequence from region 1-143aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hrp1, Rv2626cHypoxic response protein 1, HRP1

UniProt

P9WJA3

Expression Region

1-143aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-143aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFAP4 (BHLHC41, Transcription Factor AP-4, Activating Enhancer-binding Protein 4, Class C Basic Helix-loop-helix Protein 41) (MaxLight 750) discontinued
134355-ML750 100 µL

TFAP4 (BHLHC41, Transcription Factor AP-4, Activating Enhancer-binding Protein 4, Class C Basic Helix-loop-helix Protein 41) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Anti-ACE2
orb1133478 100 µL

Anti-ACE2

Sign In for Pricing
View Details
SEL1L Rabbit Polyclonal Antibody (PE-Cy5)
orb892586 100 µL

SEL1L Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
nrdA Antibody, FITC conjugated
A51242-100UG 100 µg

nrdA Antibody, FITC conjugated

Sign In for Pricing
View Details
Mouse Monoclonal Dihydrofolate Reductase/DHFR Antibody (OTI6G7) [FITC]
NBP2-70569F 0.1 mL

Mouse Monoclonal Dihydrofolate Reductase/DHFR Antibody (OTI6G7) [FITC]

Sign In for Pricing
View Details
Human Thyroglobulin (TG) ELISA Kit
MBS2701682-01 24 Strip Well

Human Thyroglobulin (TG) ELISA Kit

Sign In for Pricing
View Details