Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant Endochitinase protein

This Plant Endochitinase protein spans the amino acid sequence from region 1-200aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endochitinase, EC 3.2.1.14, Fragments

UniProt

P86181

Expression Region

1-200aa

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Avena sativa (Oat)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-taggedExpression Region: 1-200aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VSSVISSSLFEKMLLHRGFYTYDAFIAAAKSFPAFATTGSTDVRKREVAAFLAQTSHETTGGWPTAPDGPYELGSTSDYFGRGPIQISYNYNYGAAGKAIGVDLLRNPDLVTSDNTVEFKTALWFWMTPQSPKPSSHDVITGRWSPSSTDKAAGRVPGYGVLTNIIDGGVECGKGQESHVADRIGYYKDNLDCYNQKPFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Endometriotic tissue
CS807837 5x 5 µm

Tissue FFPE Sections, Endometriotic tissue

Sign In for Pricing
View Details
21-Deoxy Cortisone
TRC-D232610-50MG 50 mg

21-Deoxy Cortisone

Sign In for Pricing
View Details
Human BAZ2B activation kit by CRISPRa
GA109366 1 Kit

Human BAZ2B activation kit by CRISPRa

Sign In for Pricing
View Details
GPR172B Polyclonal Antibody
E-AB-13279-01 20 µL

GPR172B Polyclonal Antibody

Sign In for Pricing
View Details
GPR172B Polyclonal Antibody
E-AB-13279-02 60 µL

GPR172B Polyclonal Antibody

Sign In for Pricing
View Details
GPR172B Polyclonal Antibody
E-AB-13279-03 120 µL

GPR172B Polyclonal Antibody

Sign In for Pricing
View Details