Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IGF-1 protein

This Human IGF-1 protein spans the amino acid sequence from region 49-118aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mechano growth factor

UniProt

P05019

Expression Region

49-118aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 49-118aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSTN Recombinant Protein
OPCD05415-200UG 200 µg

MSTN Recombinant Protein

Sign In for Pricing
View Details
GOLPH3 (NM_022130) Human Untagged Clone
SC323962 10 µg

GOLPH3 (NM_022130) Human Untagged Clone

Sign In for Pricing
View Details
Olfr799 Protein Vector (Mouse) (pPM-C-His)
PV211709 500 ng

Olfr799 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
SSX2IP Protein Lysate (Mouse) with C-HA Tag
45574035 100 µg

SSX2IP Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Human Chimeric PL-7 IgG antibody
B2013619 0.1 mg

Human Chimeric PL-7 IgG antibody

Sign In for Pricing
View Details
Low Sample Volume ELISA Kit for Peptidase D (PEPD)
TRV-0046363-01 24 Tests

Low Sample Volume ELISA Kit for Peptidase D (PEPD)

Sign In for Pricing
View Details