Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IGF-1 protein

This Human IGF-1 protein spans the amino acid sequence from region 49-118aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mechano growth factor

UniProt

P05019

Expression Region

49-118aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 49-118aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIF3L1 Rabbit Polyclonal Antibody (FITC)
orb2082132 100 µL

NIF3L1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Cep112 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7569808 1.0 µg DNA

Cep112 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
5-Benzyl-10-oxo-10,11-dihydro-5H-dibenz[b, f]azepine
262336-01 2 mg

5-Benzyl-10-oxo-10,11-dihydro-5H-dibenz[b, f]azepine

Sign In for Pricing
View Details
5-Benzyl-10-oxo-10,11-dihydro-5H-dibenz[b, f]azepine
262336-02 5 mg

5-Benzyl-10-oxo-10,11-dihydro-5H-dibenz[b, f]azepine

Sign In for Pricing
View Details
5-Benzyl-10-oxo-10,11-dihydro-5H-dibenz[b, f]azepine
262336-03 10 mg

5-Benzyl-10-oxo-10,11-dihydro-5H-dibenz[b, f]azepine

Sign In for Pricing
View Details
5-Benzyl-10-oxo-10,11-dihydro-5H-dibenz[b, f]azepine
262336-04 25 mg

5-Benzyl-10-oxo-10,11-dihydro-5H-dibenz[b, f]azepine

Sign In for Pricing
View Details