Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse LY6E protein

This Mouse LY6E protein spans the amino acid sequence from region 21-102aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Stem cell antigen 2 Thymic shared antigen 1

UniProt

Q64253

Expression Region

21-102aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 21-102aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Catenin, Beta 1 ELISA Kit
MBS761805-01 48 Well

Mouse Catenin, Beta 1 ELISA Kit

Sign In for Pricing
View Details
Mouse Catenin, Beta 1 ELISA Kit
MBS761805-02 96 Well

Mouse Catenin, Beta 1 ELISA Kit

Sign In for Pricing
View Details
Mouse Catenin, Beta 1 ELISA Kit
MBS761805-03 5x 96 Well

Mouse Catenin, Beta 1 ELISA Kit

Sign In for Pricing
View Details
Mouse Catenin, Beta 1 ELISA Kit
MBS761805-04 10x 96 Well

Mouse Catenin, Beta 1 ELISA Kit

Sign In for Pricing
View Details
THEG ORF Vector (Human) (pORF)
ORF010490 1.0 µg DNA

THEG ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse WAP four-disulfide core domain protein 1 (WFDC1) ELISA Kit
MBS7246422-01 48 Well

Mouse WAP four-disulfide core domain protein 1 (WFDC1) ELISA Kit

Sign In for Pricing
View Details