Mouse LY6E protein
This Mouse LY6E protein spans the amino acid sequence from region 21-102aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Stem cell antigen 2 Thymic shared antigen 1
UniProt
Q64253
Expression Region
21-102aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
13.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 21-102aaSequence Info: Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A11544-1-Fluoro488 100 µg/Vial
Anti-TRIM44 Antibody Picoband® Fluoro488 Conjugated
Sign In for Pricing
View Details 
T3418 1x106 cells / 1.0 mL
HEK293 Stably Expressing Mutant Myocilin Cell Line (pTRE-Y437H MYOC)
Sign In for Pricing
View Details 
orb3031492-01 100 mg
Benzo[b]thiophen-2-ylmethyl-methyl-ammonium chloride
Sign In for Pricing
View Details orb3031492-02 2 mg
Benzo[b]thiophen-2-ylmethyl-methyl-ammonium chloride
Sign In for Pricing
View Details