Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CAMP protein

This Human CAMP protein spans the amino acid sequence from region 132-170aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

18KDA cationic antimicrobial protein

UniProt

P49913

Expression Region

132-170aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 132-170aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human FLVCR2 shRNA (UAS) - Lentiviral human FLVCR2 shRNA (UAS, RFP) (100)
GTR15321027 1 Vial

Lentiviral human FLVCR2 shRNA (UAS) - Lentiviral human FLVCR2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
CCI-006
BA8008-5 5 mg

CCI-006

Sign In for Pricing
View Details
ATXN3L Polyclonal Antibody, Cy5 Conjugated
bs-4807R-Cy5 100 µL

ATXN3L Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Glutamic Acid (Glu) Content Assay Kit
AK0417-50T-48S 50 Tests - 48 Samples

Glutamic Acid (Glu) Content Assay Kit

Sign In for Pricing
View Details
TPTE Antibody, HRP conjugated
A37365-100UG 100 µg

TPTE Antibody, HRP conjugated

Sign In for Pricing
View Details
ABCA2 Polyclonal Antibody
MBS2528723-01 0.02 mL

ABCA2 Polyclonal Antibody

Sign In for Pricing
View Details