Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ATP6AP2 protein

This Human ATP6AP2 protein spans the amino acid sequence from region 17-350aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATPase H (+) -transporting lysosomal accessory protein 2 ATPase H (+) -transporting lysosomal-interacting protein 2 ER-localized type I transmembrane adaptor Embryonic liver differentiation factor 10 N14F Renin/prorenin receptor Vacuolar ATP synthase membrane sector-associated protein M8-9

UniProt

O75787

Expression Region

17-350aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 17-350aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD99 MAb (Clone 1021527)
MAB3968-100 100 µg

Human CD99 MAb (Clone 1021527)

Sign In for Pricing
View Details
WASF2 Rabbit Polyclonal Antibody
E53P07146 100 µL

WASF2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Agarose I/TBE Blend, 1.5%
40100097-1 100 g

Agarose I/TBE Blend, 1.5%

Sign In for Pricing
View Details
RCC1 Rabbit pAb
E2506350 100 µL

RCC1 Rabbit pAb

Sign In for Pricing
View Details
PKC Alpha Polyclonal Antibody
BT-AP07208-01 20 µL

PKC Alpha Polyclonal Antibody

Sign In for Pricing
View Details
PKC Alpha Polyclonal Antibody
BT-AP07208-02 50 µL

PKC Alpha Polyclonal Antibody

Sign In for Pricing
View Details