Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse KLK14 protein

This Mouse KLK14 protein spans the amino acid sequence from region 24-250aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glandular kallikrein KLK14

UniProt

Q8CGR5

Expression Region

24-250aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Disease Biomarkers

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 24-250aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IIGGYRCVRNSQPWQVALQAGPGHRFLCGGVLLSDQWVITAAHCARPILHVALGKHNIRRWEATQQVVRVARQVPHPQYQPQAHDNDLMLLKLQKKVRLGRAVKTISVASSCASPGTPCRVSGWGTIASPIARYPTALQCVNVNIMSEQACHRAYPGIITSGMVCAGVPEGGKDSCQGDSGGPLVCGGQLQGLVSWGMERCAMPGYPGVYANLCNYHSWIQRTMQSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RXRG (Retinoid X Receptor, gamma, NR2B3, RXRC)
251366 200 µL

RXRG (Retinoid X Receptor, gamma, NR2B3, RXRC)

Sign In for Pricing
View Details
CHST1 Rabbit Polyclonal Antibody (APC-Cy7)
orb1588546 100 µL

CHST1 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Fas/CD95, Human (HEK293, Fc)
HY-P73047 1 Each

Fas/CD95, Human (HEK293, Fc)

Sign In for Pricing
View Details
Mouse Mmp25/Matrix metalloproteinase-25 ELISA Kit
MBS2905135-01 48 Well

Mouse Mmp25/Matrix metalloproteinase-25 ELISA Kit

Sign In for Pricing
View Details
Mouse Mmp25/Matrix metalloproteinase-25 ELISA Kit
MBS2905135-02 96 Well

Mouse Mmp25/Matrix metalloproteinase-25 ELISA Kit

Sign In for Pricing
View Details
Mouse Mmp25/Matrix metalloproteinase-25 ELISA Kit
MBS2905135-03 5x 96 Well

Mouse Mmp25/Matrix metalloproteinase-25 ELISA Kit

Sign In for Pricing
View Details