Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse KLK14 protein

This Mouse KLK14 protein spans the amino acid sequence from region 24-250aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glandular kallikrein KLK14

UniProt

Q8CGR5

Expression Region

24-250aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Disease Biomarkers

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 24-250aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IIGGYRCVRNSQPWQVALQAGPGHRFLCGGVLLSDQWVITAAHCARPILHVALGKHNIRRWEATQQVVRVARQVPHPQYQPQAHDNDLMLLKLQKKVRLGRAVKTISVASSCASPGTPCRVSGWGTIASPIARYPTALQCVNVNIMSEQACHRAYPGIITSGMVCAGVPEGGKDSCQGDSGGPLVCGGQLQGLVSWGMERCAMPGYPGVYANLCNYHSWIQRTMQSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Parvalbumin Alpha/PVALB Protein (His Tag)
MBS2580313-01 0.02 mg

Recombinant Human Parvalbumin Alpha/PVALB Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Parvalbumin Alpha/PVALB Protein (His Tag)
MBS2580313-02 0.1 mg

Recombinant Human Parvalbumin Alpha/PVALB Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Parvalbumin Alpha/PVALB Protein (His Tag)
MBS2580313-03 5x 0.1 mg

Recombinant Human Parvalbumin Alpha/PVALB Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus subsp. pastoris Cysteine--tRNA ligase (cysS)
MBS1428778-01 0.02 mg (E-Coli)

Recombinant Prochlorococcus marinus subsp. pastoris Cysteine--tRNA ligase (cysS)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus subsp. pastoris Cysteine--tRNA ligase (cysS)
MBS1428778-02 0.02 mg (Yeast)

Recombinant Prochlorococcus marinus subsp. pastoris Cysteine--tRNA ligase (cysS)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus subsp. pastoris Cysteine--tRNA ligase (cysS)
MBS1428778-03 0.1 mg (E-Coli)

Recombinant Prochlorococcus marinus subsp. pastoris Cysteine--tRNA ligase (cysS)

Sign In for Pricing
View Details