Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse KLK14 protein

This Mouse KLK14 protein spans the amino acid sequence from region 24-250aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glandular kallikrein KLK14

UniProt

Q8CGR5

Expression Region

24-250aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Disease Biomarkers

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 24-250aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IIGGYRCVRNSQPWQVALQAGPGHRFLCGGVLLSDQWVITAAHCARPILHVALGKHNIRRWEATQQVVRVARQVPHPQYQPQAHDNDLMLLKLQKKVRLGRAVKTISVASSCASPGTPCRVSGWGTIASPIARYPTALQCVNVNIMSEQACHRAYPGIITSGMVCAGVPEGGKDSCQGDSGGPLVCGGQLQGLVSWGMERCAMPGYPGVYANLCNYHSWIQRTMQSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Paralemmin ELISA Kit
MBS105039-01 48 Well

Bovine Paralemmin ELISA Kit

Sign In for Pricing
View Details
Bovine Paralemmin ELISA Kit
MBS105039-02 96 Well

Bovine Paralemmin ELISA Kit

Sign In for Pricing
View Details
Bovine Paralemmin ELISA Kit
MBS105039-03 5x 96 Well

Bovine Paralemmin ELISA Kit

Sign In for Pricing
View Details
Bovine Paralemmin ELISA Kit
MBS105039-04 10x 96 Well

Bovine Paralemmin ELISA Kit

Sign In for Pricing
View Details
C3 Pipette 12 Channel 0.5-10ul
LHC37114001 1 Unit

C3 Pipette 12 Channel 0.5-10ul

Sign In for Pricing
View Details
SNAPIN ORF Vector (Human) (pORF)
ORF032630 1.0 µg DNA

SNAPIN ORF Vector (Human) (pORF)

Sign In for Pricing
View Details