What is the catalog number for Human LMP1 protein?

The catalog number for Human LMP1 protein is orb418897.

What sizes are available for Human LMP1 protein?

Human LMP1 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human LMP1 protein come in?

Human LMP1 protein is available in 3 different pack sizes.

Is Human LMP1 protein in stock?

Human LMP1 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human LMP1 protein

This Human LMP1 protein spans the amino acid sequence from region 185-366aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein p63

UniProt

P0C741

Expression Region

185-366aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-taggedExpression Region: 185-366aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YFHGPRHTDEHHHDDSLPHPQQATDDSSHESDSNSNEGRHHLLVSGAGDGPPLCSQNLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGNTDDNGPQDPDNTDDNGPHDPLPHNPSDSAGNDGGPPNLTEEVENKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD