Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LMP1 protein

This Human LMP1 protein spans the amino acid sequence from region 185-366aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein p63

UniProt

P0C741

Expression Region

185-366aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-taggedExpression Region: 185-366aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YFHGPRHTDEHHHDDSLPHPQQATDDSSHESDSNSNEGRHHLLVSGAGDGPPLCSQNLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGNTDDNGPQDPDNTDDNGPHDPLPHNPSDSAGNDGGPPNLTEEVENKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SensiStain™ Anti-Cyclin D1 Antibody
HY500158 0.1 mL

SensiStain™ Anti-Cyclin D1 Antibody

Sign In for Pricing
View Details
PHBP10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV740220 1.0 µg DNA

PHBP10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
LRC45 rabbit pAb
UB-GEN-9411 100 µL

LRC45 rabbit pAb

Sign In for Pricing
View Details
ADCK4 (Uncharacterized aarF Domain-containing Protein Kinase 4, FLJ12229)
122994 100 µg

ADCK4 (Uncharacterized aarF Domain-containing Protein Kinase 4, FLJ12229)

Sign In for Pricing
View Details
Figitumumab ELISA Kit
orb2975797 96 Tests

Figitumumab ELISA Kit

Sign In for Pricing
View Details
CDC37L1 Antibody
A16733-100UL 100 µL

CDC37L1 Antibody

Sign In for Pricing
View Details