Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LMP1 protein

This Human LMP1 protein spans the amino acid sequence from region 185-366aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein p63

UniProt

P0C741

Expression Region

185-366aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-taggedExpression Region: 185-366aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YFHGPRHTDEHHHDDSLPHPQQATDDSSHESDSNSNEGRHHLLVSGAGDGPPLCSQNLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGNTDDNGPQDPDNTDDNGPHDPLPHNPSDSAGNDGGPPNLTEEVENKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 4-amino-1H-pyrazole-5-carboxylate
sc-327429 500 mg

Ethyl 4-amino-1H-pyrazole-5-carboxylate

Sign In for Pricing
View Details
MRXS5 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV734253 1.0 µg DNA

MRXS5 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Recombinant Bordetella Parapertussis hisS Protein (aa 1-428)
VAng-Lsx4543-50gEcoli 50 µg (E. coli)

Recombinant Bordetella Parapertussis hisS Protein (aa 1-428)

Sign In for Pricing
View Details
1X High Sensitivity dsDNA Quantification Kit, 100 assays
F1000-HS1-100 1 Each

1X High Sensitivity dsDNA Quantification Kit, 100 assays

Sign In for Pricing
View Details
DDX41 Lentiviral Activation Particles (m)
sc-428469-LAC 200 µL

DDX41 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
ROCK2 Mouse Monoclonal Antibody
AG4463 50 µL

ROCK2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details