Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LMP1 protein

This Human LMP1 protein spans the amino acid sequence from region 185-366aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein p63

UniProt

P0C741

Expression Region

185-366aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 185-366aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YFHGPRHTDEHHHDDSLPHPQQATDDSSHESDSNSNEGRHHLLVSGAGDGPPLCSQNLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGNTDDNGPQDPDNTDDNGPHDPLPHNPSDSAGNDGGPPNLTEEVENKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

REP-2 Double Nickase Plasmid (m2)
sc-419653-NIC-2 20 µg

REP-2 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Human Ephrin type-B receptor 3, EPHB3 ELISA Kit
MBS1606165-01 48 Well

Human Ephrin type-B receptor 3, EPHB3 ELISA Kit

Sign In for Pricing
View Details
Human Ephrin type-B receptor 3, EPHB3 ELISA Kit
MBS1606165-02 96 Well

Human Ephrin type-B receptor 3, EPHB3 ELISA Kit

Sign In for Pricing
View Details
Human Ephrin type-B receptor 3, EPHB3 ELISA Kit
MBS1606165-03 5x 96 Well

Human Ephrin type-B receptor 3, EPHB3 ELISA Kit

Sign In for Pricing
View Details
Human Ephrin type-B receptor 3, EPHB3 ELISA Kit
MBS1606165-04 10x 96 Well

Human Ephrin type-B receptor 3, EPHB3 ELISA Kit

Sign In for Pricing
View Details
FBXO11 Rabbit Polyclonal Antibody (PerCP)
orb2383260 100 µL

FBXO11 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details