Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse LY6E protein

This Mouse LY6E protein spans the amino acid sequence from region 21-102aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Stem cell antigen 2 Thymic shared antigen 1

UniProt

Q64253

Expression Region

21-102aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-B2M-taggedExpression Region: 21-102aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BTNL2 activation kit by CRISPRa
GA111160 1 Kit

Human BTNL2 activation kit by CRISPRa

Sign In for Pricing
View Details
PTN Polyclonal Antibody
ABP53250-01 30 µL

PTN Polyclonal Antibody

Sign In for Pricing
View Details
PTN Polyclonal Antibody
ABP53250-02 100 µL

PTN Polyclonal Antibody

Sign In for Pricing
View Details
PTN Polyclonal Antibody
ABP53250-03 200 µL

PTN Polyclonal Antibody

Sign In for Pricing
View Details
Anserini LF/LTF Ab-lgG ELISA Kit
EAL0232 96 Tests

Anserini LF/LTF Ab-lgG ELISA Kit

Sign In for Pricing
View Details
Recombinant Caenorhabditis briggsae Molybdopterin synthase sulfur carrier subunit (CBG26118)
MBS1189166-01 0.02 mg (E-Coli)

Recombinant Caenorhabditis briggsae Molybdopterin synthase sulfur carrier subunit (CBG26118)

Sign In for Pricing
View Details