Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human C1ORF54 protein

This Human C1ORF54 protein spans the amino acid sequence from region 17-131aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C1orf54Uncharacterized protein C1orf54

UniProt

Q8WWF1

Expression Region

17-131aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-B2M-taggedExpression Region: 17-131aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEYEDEERLGEDEYYQVVYYYTVTPSYDDFSADFTIDYSIFESEDRLNRLDKDITEAIETTISLETARADHPKPVTVKPVTTEPSPDLNDAVSSLRSPIPLLLSCAFVQVGMYFM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 488 Anti-Human CD14 Antibody[M5E2]
E-AB-F1209L-01 20 Tests

Elab Fluor® 488 Anti-Human CD14 Antibody[M5E2]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD14 Antibody[M5E2]
E-AB-F1209L-02 100 Tests

Elab Fluor® 488 Anti-Human CD14 Antibody[M5E2]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD14 Antibody[M5E2]
E-AB-F1209L-03 2x 100 Tests

Elab Fluor® 488 Anti-Human CD14 Antibody[M5E2]

Sign In for Pricing
View Details
GLRB (NM_001166061) Human Over-expression Lysate
LC431266 20 µg

GLRB (NM_001166061) Human Over-expression Lysate

Sign In for Pricing
View Details
Human NOPCHAP1 activation kit by CRISPRa
GA114733 1 Kit

Human NOPCHAP1 activation kit by CRISPRa

Sign In for Pricing
View Details
Chmp2a Mouse Gene Knockout Kit (CRISPR)
KN503277 1 Kit

Chmp2a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details