Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ATP5D protein

This Human ATP5D protein spans the amino acid sequence from region 23-168aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

F-ATPase delta subunit

UniProt

P30049

Expression Region

23-168aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Disease Biomarkers

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-taggedExpression Region: 23-168aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUSP6 Recombinant Rabbit monoclonal Antibody
HA750032 100 µL

DUSP6 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
8-Fluoro-imidazo[1,2-c]pyrimidin-5(6H)-one
TRC-F135300-1G 1 g

8-Fluoro-imidazo[1,2-c]pyrimidin-5(6H)-one

Sign In for Pricing
View Details
Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Chicken IgY,  15nm
GAF-2354-15 1 mL

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Chicken IgY, 15nm

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS716029 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Syndecan 2 (SDC2) Rabbit Polyclonal Antibody
TA381312 100 µL

Syndecan 2 (SDC2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CF®568 Rabbit Anti-RFP
20477 100 µL

CF®568 Rabbit Anti-RFP

Sign In for Pricing
View Details