Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ATP5D protein

This Human ATP5D protein spans the amino acid sequence from region 23-168aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

F-ATPase delta subunit

UniProt

P30049

Expression Region

23-168aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Disease Biomarkers

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-taggedExpression Region: 23-168aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hole-type OR lamp BOPL-204
BOPL-204 1 Unit

Hole-type OR lamp BOPL-204

Sign In for Pricing
View Details
Recombinant Human OXA Protein (Sumo Tag)
PDEH100576-01 20 µg

Recombinant Human OXA Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human OXA Protein (Sumo Tag)
PDEH100576-02 100 µg

Recombinant Human OXA Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human OXA Protein (Sumo Tag)
PDEH100576-03 500 µg

Recombinant Human OXA Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human OXA Protein (Sumo Tag)
PDEH100576-04 1 mg

Recombinant Human OXA Protein (Sumo Tag)

Sign In for Pricing
View Details
2,2-Dichloroacetic Acid-1-13C
TRC-D431828-2.5MG 2.5 mg

2,2-Dichloroacetic Acid-1-13C

Sign In for Pricing
View Details