Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant Pectate lyase 1 protein

This Plant Pectate lyase 1 protein spans the amino acid sequence from region 22-367aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Major pollen allergen Cup a 1 Allergen, Cup a 1

UniProt

Q9SCG9

Expression Region

22-367aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Hesperocyparis arizonica (Arizona cypress) (Cupressus arizonica)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 22-367aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADVHLGNGGPCLFMRKASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTRDAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSTA5 Human Gene Knockout Kit (CRISPR)
KN415990 1 Kit

GSTA5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant HSF1 Antibody
RC-6988-01 50 μL

Recombinant HSF1 Antibody

Sign In for Pricing
View Details
Recombinant HSF1 Antibody
RC-6988-02 100 µL

Recombinant HSF1 Antibody

Sign In for Pricing
View Details
Recombinant HSF1 Antibody
RC-6988-03 1 mL

Recombinant HSF1 Antibody

Sign In for Pricing
View Details
LIM Kinase 1 Recombinant Rabbit Monoclonal Antibody [PSH08-68]
HA723020 100 µL

LIM Kinase 1 Recombinant Rabbit Monoclonal Antibody [PSH08-68]

Sign In for Pricing
View Details
EMI1 (EMI1/1176), CF405S conjugate, 0.1mg/mL
BNC041176-100 1x 100 µL

EMI1 (EMI1/1176), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details