Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli FANC protein

This E. coli FANC protein spans the amino acid sequence from region 23-181aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FanCK99 fimbrial protein

UniProt

P18103

Expression Region

23-181aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 23-181aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UQCRFS1 (C-term) Rabbit Polyclonal Antibody
AP54481PU-N 400 µL

UQCRFS1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IL 13 Mouse
OM296738-01 10 µg

IL 13 Mouse

Sign In for Pricing
View Details
IL 13 Mouse
OM296738-02 2 µg

IL 13 Mouse

Sign In for Pricing
View Details
IL 13 Mouse
OM296738-03 1 mg

IL 13 Mouse

Sign In for Pricing
View Details
1-(4-(4-Hydroxyphenyl)butan-2-yl)-1H-indole-5,6-diol
TRC-H825650-50MG 50 mg

1-(4-(4-Hydroxyphenyl)butan-2-yl)-1H-indole-5,6-diol

Sign In for Pricing
View Details
Chromogranin A (LK2H10), Biotin conjugate, 0.1mg/mL
BNCB0641-100 1x 100 µL

Chromogranin A (LK2H10), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details