What is the catalog number for E. coli GHRA protein?

The catalog number for E. coli GHRA protein is orb418882.

What sizes are available for E. coli GHRA protein?

E. coli GHRA protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does E. coli GHRA protein come in?

E. coli GHRA protein is available in 3 different pack sizes.

Is E. coli GHRA protein in stock?

E. coli GHRA protein is currently made to order / not held in immediate stock. Contact us for lead time.

E. coli GHRA protein

This E. coli GHRA protein spans the amino acid sequence from region 1-312aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

2-ketoacid reductase

UniProt

B7LFE3

Expression Region

1-312aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli (strain 55989 / EAEC)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 1-312aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHPPVEMLAGRDLKAVFALGAGVDSILSKLQAHPEMLNPSVPLFRLEDTGMGEQMQEYAVSQVLHWFRRFDDYRIQQNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSRTRKSWPGVQSFAGREELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLARGVHVVEDDLLAALDSGKVKGAMLDVFNREPLPPENPLWQHPRVTITPHVAAITRPAEAVEYISRTIAQLEKGERVCGQVDRARGY