Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli GHRA protein

This E. coli GHRA protein spans the amino acid sequence from region 1-312aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

2-ketoacid reductase

UniProt

B7LFE3

Expression Region

1-312aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli (strain 55989 / EAEC)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 1-312aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHPPVEMLAGRDLKAVFALGAGVDSILSKLQAHPEMLNPSVPLFRLEDTGMGEQMQEYAVSQVLHWFRRFDDYRIQQNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSRTRKSWPGVQSFAGREELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLARGVHVVEDDLLAALDSGKVKGAMLDVFNREPLPPENPLWQHPRVTITPHVAAITRPAEAVEYISRTIAQLEKGERVCGQVDRARGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-HOXB13 Antibody Picoband® APC Conjugated
A00908-3-APC 100 µg/Vial

Anti-HOXB13 Antibody Picoband® APC Conjugated

Sign In for Pricing
View Details
BAI3 Antibody (ARP85374_P050)
ARP85374_P050 100 µL

BAI3 Antibody (ARP85374_P050)

Sign In for Pricing
View Details
Rabbit Polyclonal EVX2 Antibody
NBP2-83028-0.1mL 0.1 mL

Rabbit Polyclonal EVX2 Antibody

Sign In for Pricing
View Details
Recombinant Human CD24 Protein, Fc Tag
KMH179 50 µg

Recombinant Human CD24 Protein, Fc Tag

Sign In for Pricing
View Details
Lentiviral mouse Gm15881 shRNA (UAS) - Lentiviral mouse Gm15881 shRNA (UAS, RFP) plasmid
GTR15217549 1 Vial

Lentiviral mouse Gm15881 shRNA (UAS) - Lentiviral mouse Gm15881 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
EZH2 Antibody
A54274-100UL 100 µL

EZH2 Antibody

Sign In for Pricing
View Details