Rabbit Apolipoprotein E protein
This Rabbit Apolipoprotein E protein spans the amino acid sequence from region 20-311aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
APOEApolipoprotein E, Apo-E
UniProt
P18287
Expression Region
20-311aa
Tag
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Oryctolagus cuniculus (Rabbit)
Field of Research
Metabolism Research
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
53.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 20-311aaSequence Info: Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15184956 1 Vial
Lentiviral mouse Pkn3 shRNA (UAS) - Lentiviral mouse Pkn3 shRNA (UAS, RFP) (100)
Sign In for Pricing
View Details 
ITC19526-01 50 mg
1- (5-Chloro-2,4-dimethoxyphenyl) -3,3-dimethylurea
Sign In for Pricing
View Details ITC19526-02 0.5 g
1- (5-Chloro-2,4-dimethoxyphenyl) -3,3-dimethylurea
Sign In for Pricing
View Details MBS520148-01 0.05 mg
Anti-Mouse CD45, PE (Clone IBL-5/25) (rat IgG1)
Sign In for Pricing
View Details