What is the catalog number for Rat FXN protein?

The catalog number for Rat FXN protein is orb418880.

What sizes are available for Rat FXN protein?

Rat FXN protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Rat FXN protein come in?

Rat FXN protein is available in 3 different pack sizes.

Is Rat FXN protein in stock?

Rat FXN protein is currently made to order / not held in immediate stock. Contact us for lead time.

Rat FXN protein

This Rat FXN protein spans the amino acid sequence from region 41-208aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FxnFrataxin, mitochondrial, Fxn, EC 1.16.3.1) [Cleaved into, Frataxin intermediate form, Frataxin mature form]

UniProt

D3ZYW7

Expression Region

41-208aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-taggedExpression Region: 41-208aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LHVTANADAIRHSHLNLHYLGQILNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPLLYLWFSGPCSGPKRYDWTGKNWVYSHDGVSLHELLARELTEALNTKLDLSSLAYSGKGT