Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat FXN protein

This Rat FXN protein spans the amino acid sequence from region 41-208aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FxnFrataxin, mitochondrial, Fxn, EC 1.16.3.1) [Cleaved into, Frataxin intermediate form, Frataxin mature form]

UniProt

D3ZYW7

Expression Region

41-208aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-taggedExpression Region: 41-208aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LHVTANADAIRHSHLNLHYLGQILNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPLLYLWFSGPCSGPKRYDWTGKNWVYSHDGVSLHELLARELTEALNTKLDLSSLAYSGKGT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-African malaria mosquito SPCLIP1 Antibody-FITC Conjugate
DZ33985-FITC 200 µL/Vial

Anti-African malaria mosquito SPCLIP1 Antibody-FITC Conjugate

Sign In for Pricing
View Details
PIAS1, CT E3 SUMO-protein Ligase PIAS1, Protein Inhibitor of Activated STAT Protein 1, Gu Binding Protein, GBP, RNA Helicase II Binding Protein, DEAD/H Box-binding Protein 1, DDXBP1) (MaxLight 550)
MBS6493373-01 0.1 mL

PIAS1, CT E3 SUMO-protein Ligase PIAS1, Protein Inhibitor of Activated STAT Protein 1, Gu Binding Protein, GBP, RNA Helicase II Binding Protein, DEAD/H Box-binding Protein 1, DDXBP1) (MaxLight 550)

Sign In for Pricing
View Details
PIAS1, CT E3 SUMO-protein Ligase PIAS1, Protein Inhibitor of Activated STAT Protein 1, Gu Binding Protein, GBP, RNA Helicase II Binding Protein, DEAD/H Box-binding Protein 1, DDXBP1) (MaxLight 550)
MBS6493373-02 5x 0.1 mL

PIAS1, CT E3 SUMO-protein Ligase PIAS1, Protein Inhibitor of Activated STAT Protein 1, Gu Binding Protein, GBP, RNA Helicase II Binding Protein, DEAD/H Box-binding Protein 1, DDXBP1) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant Pasteurella Multocida adk Protein (aa 1-214)
VAng-Cr6695-50gEcoli 50 µg (E. coli)

Recombinant Pasteurella Multocida adk Protein (aa 1-214)

Sign In for Pricing
View Details
NUP43, ID (NUP43, Nucleoporin Nup43, Nup107-160 subcomplex subunit Nup43, p42) (MaxLight 550)
MBS6327289-01 0.1 mL

NUP43, ID (NUP43, Nucleoporin Nup43, Nup107-160 subcomplex subunit Nup43, p42) (MaxLight 550)

Sign In for Pricing
View Details
NUP43, ID (NUP43, Nucleoporin Nup43, Nup107-160 subcomplex subunit Nup43, p42) (MaxLight 550)
MBS6327289-02 5x 0.1 mL

NUP43, ID (NUP43, Nucleoporin Nup43, Nup107-160 subcomplex subunit Nup43, p42) (MaxLight 550)

Sign In for Pricing
View Details