Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat FXN protein

This Rat FXN protein spans the amino acid sequence from region 41-208aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FxnFrataxin, mitochondrial, Fxn, EC 1.16.3.1) [Cleaved into, Frataxin intermediate form, Frataxin mature form]

UniProt

D3ZYW7

Expression Region

41-208aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-taggedExpression Region: 41-208aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LHVTANADAIRHSHLNLHYLGQILNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPLLYLWFSGPCSGPKRYDWTGKNWVYSHDGVSLHELLARELTEALNTKLDLSSLAYSGKGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Inhibin B (INHB) ELISA Kit
orb1807395-01 48 Tests

Human Inhibin B (INHB) ELISA Kit

Sign In for Pricing
View Details
Human Inhibin B (INHB) ELISA Kit
orb1807395-02 96 Tests

Human Inhibin B (INHB) ELISA Kit

Sign In for Pricing
View Details
Anti-PAI-3 (Rabbit, Polyclonal, IgG)
A105248 100 µL

Anti-PAI-3 (Rabbit, Polyclonal, IgG)

Sign In for Pricing
View Details
ZNF816 (Biotin)
582474-01 50 µg

ZNF816 (Biotin)

Sign In for Pricing
View Details
ZNF816 (Biotin)
582474-02 100 µg

ZNF816 (Biotin)

Sign In for Pricing
View Details
OAEC04360-100UL - NPPB Antibody
OAEC04360-100UL 100 µg / 100 µL

OAEC04360-100UL - NPPB Antibody

Sign In for Pricing
View Details