Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat FXN protein

This Rat FXN protein spans the amino acid sequence from region 41-208aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FxnFrataxin, mitochondrial, Fxn, EC 1.16.3.1) [Cleaved into, Frataxin intermediate form, Frataxin mature form]

UniProt

D3ZYW7

Expression Region

41-208aa

Tag

Tag-Free

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 41-208aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LHVTANADAIRHSHLNLHYLGQILNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPLLYLWFSGPCSGPKRYDWTGKNWVYSHDGVSLHELLARELTEALNTKLDLSSLAYSGKGT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dpy19l4 (NM_001081201) Mouse Untagged Clone
MC221136 10 µg

Dpy19l4 (NM_001081201) Mouse Untagged Clone

Sign In for Pricing
View Details
GAS6 siRNA (Human)
CRH1737-01 15 nmol

GAS6 siRNA (Human)

Sign In for Pricing
View Details
GAS6 siRNA (Human)
CRH1737-02 30 nmol

GAS6 siRNA (Human)

Sign In for Pricing
View Details
Recombinant Human Lipase Maturation Factor 1 (LMF1)
RPU57277-01 50 µg

Recombinant Human Lipase Maturation Factor 1 (LMF1)

Sign In for Pricing
View Details
Recombinant Human Lipase Maturation Factor 1 (LMF1)
RPU57277-02 100 µg

Recombinant Human Lipase Maturation Factor 1 (LMF1)

Sign In for Pricing
View Details
Recombinant Human Lipase Maturation Factor 1 (LMF1)
RPU57277-03 1 mg

Recombinant Human Lipase Maturation Factor 1 (LMF1)

Sign In for Pricing
View Details