Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human H2AFX protein

This Human H2AFX protein spans the amino acid sequence from region 1-143aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H2A.X

UniProt

P16104

Expression Region

1-143aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal GST-taggedExpression Region: 1-143aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAB2 Polyclonal Antibody
E-AB-11250-01 20 µL

GAB2 Polyclonal Antibody

Sign In for Pricing
View Details
GAB2 Polyclonal Antibody
E-AB-11250-02 60 µL

GAB2 Polyclonal Antibody

Sign In for Pricing
View Details
GAB2 Polyclonal Antibody
E-AB-11250-03 120 µL

GAB2 Polyclonal Antibody

Sign In for Pricing
View Details
GAB2 Polyclonal Antibody
E-AB-11250-04 200 µL

GAB2 Polyclonal Antibody

Sign In for Pricing
View Details
NKG2A (KLRC1) Human Gene Knockout Kit (CRISPR)
KN203062BN 1 Kit

NKG2A (KLRC1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Chromogranin A (CGA414 + CGA/777 + CGA/798), CF740 conjugate, 0.1mg/mL
BNC741060-100 1x 100 µL

Chromogranin A (CGA414 + CGA/777 + CGA/798), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details