Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SULT1A3 protein

This Human SULT1A3 protein spans the amino acid sequence from region 1-295aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aryl sulfotransferase 1A3/1A4 Catecholamine-sulfating phenol sulfotransferase HAST3 M-PST Monoamine-sulfating phenol sulfotransferase Placental estrogen sulfotransferase Sulfotransferase 1A3/1A4 Sulfotransferase, monoamine-preferring Thermolabile phenol sulfotransferase

UniProt

P0DMM9

Expression Region

1-295aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

61.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal GST-taggedExpression Region: 1-295aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL31RA Human Gene Knockout Kit (CRISPR)
KN418212 1 Kit

IL31RA Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MTHFD2 (NM_006636) Human Over-expression Lysate
LY401984 100 µg

MTHFD2 (NM_006636) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Cartilage
CS806014 5x 5 µm

Tissue FFPE Sections, Cartilage

Sign In for Pricing
View Details
Recombinant PRC1 (phospho T481) Antibody
RC-4760-01 50 μL

Recombinant PRC1 (phospho T481) Antibody

Sign In for Pricing
View Details
Recombinant PRC1 (phospho T481) Antibody
RC-4760-02 100 µL

Recombinant PRC1 (phospho T481) Antibody

Sign In for Pricing
View Details
Recombinant PRC1 (phospho T481) Antibody
RC-4760-03 1 mL

Recombinant PRC1 (phospho T481) Antibody

Sign In for Pricing
View Details