Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human UL111A protein

This Human UL111A protein spans the amino acid sequence from region 26-176aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UL111A, Viral interleukin-10 homolog, cmvIL-10, vIL-10

UniProt

F5HC71

Expression Region

26-176aa

Tag

Tag-Free

Source

E.coli

Origin

Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)

Field of Research

Epigenetics, Infectious Diseases, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 26-176aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATTTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD33 Recombinant Protein
PROTP20138-50ug 50 µg

Human CD33 Recombinant Protein

Sign In for Pricing
View Details
CD33 antibody
10R-2007 100 µL

CD33 antibody

Sign In for Pricing
View Details
DEFB113 Protein Vector (Human) (pPB-N-His)
PV072714 500 ng

DEFB113 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Ursolic Acid discontinued. See 291827
301092 20 mg

Ursolic Acid discontinued. See 291827

Sign In for Pricing
View Details
Cardboard box White, 75mm, W. divider 5x5=25 Eppendorf 5 ml
TE22860 36 Cases

Cardboard box White, 75mm, W. divider 5x5=25 Eppendorf 5 ml

Sign In for Pricing
View Details
Cytokeratin 17 Antibody
orb2637824 7 mL

Cytokeratin 17 Antibody

Sign In for Pricing
View Details