Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human UL111A protein

This Human UL111A protein spans the amino acid sequence from region 26-176aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UL111A, Viral interleukin-10 homolog, cmvIL-10, vIL-10

UniProt

F5HC71

Expression Region

26-176aa

Tag

Tag-Free

Source

E.coli

Origin

Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)

Field of Research

Epigenetics, Infectious Diseases, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 26-176aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATTTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPKOW Recombinant Protein (Human)
RP013744 100 µg

GPKOW Recombinant Protein (Human)

Sign In for Pricing
View Details
Human RFTN1/Raftlin ELISA Kit
MBS2905042-01 48 Well

Human RFTN1/Raftlin ELISA Kit

Sign In for Pricing
View Details
Human RFTN1/Raftlin ELISA Kit
MBS2905042-02 96 Well

Human RFTN1/Raftlin ELISA Kit

Sign In for Pricing
View Details
Human RFTN1/Raftlin ELISA Kit
MBS2905042-03 5x 96 Well

Human RFTN1/Raftlin ELISA Kit

Sign In for Pricing
View Details
Human RFTN1/Raftlin ELISA Kit
MBS2905042-04 10x 96 Well

Human RFTN1/Raftlin ELISA Kit

Sign In for Pricing
View Details
GLT8D1 Antibody (Biotin)
orb30970-01 50 µg

GLT8D1 Antibody (Biotin)

Sign In for Pricing
View Details