Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Primate CCL20 protein

This Primate CCL20 protein spans the amino acid sequence from region 27-96aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q8HYP6

Expression Region

27-96aa

Tag

N-terminal 10xHis-GST-tagged

Source

E.coli

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-GST-taggedExpression Region: 27-96aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASNFDCCLRYTDRILHPKFIVGFTQQLANETCDINAVVFHTKKGLSVCANPKQTWVKLIVRRLSKKINKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Alpha-mannosidase 2x (MAN2A2) ELISA Kit
MBS7233265-01 48 Well

Chicken Alpha-mannosidase 2x (MAN2A2) ELISA Kit

Sign In for Pricing
View Details
Chicken Alpha-mannosidase 2x (MAN2A2) ELISA Kit
MBS7233265-02 96 Well

Chicken Alpha-mannosidase 2x (MAN2A2) ELISA Kit

Sign In for Pricing
View Details
Chicken Alpha-mannosidase 2x (MAN2A2) ELISA Kit
MBS7233265-03 5x 96 Well

Chicken Alpha-mannosidase 2x (MAN2A2) ELISA Kit

Sign In for Pricing
View Details
Chicken Alpha-mannosidase 2x (MAN2A2) ELISA Kit
MBS7233265-04 10x 96 Well

Chicken Alpha-mannosidase 2x (MAN2A2) ELISA Kit

Sign In for Pricing
View Details
Guinea Pig IgG F (ab') 2 Peroxidase Antibody
orb346145 1 mg

Guinea Pig IgG F (ab') 2 Peroxidase Antibody

Sign In for Pricing
View Details
CYP1A2 Rabbit Polyclonal Antibody (AP)
orb1597417 100 µL

CYP1A2 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details