Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Primate CCL20 protein

This Primate CCL20 protein spans the amino acid sequence from region 27-96aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q8HYP6

Expression Region

27-96aa

Tag

N-terminal 10xHis-GST-tagged

Source

E.coli

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-GST-taggedExpression Region: 27-96aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASNFDCCLRYTDRILHPKFIVGFTQQLANETCDINAVVFHTKKGLSVCANPKQTWVKLIVRRLSKKINKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-Gly-Gly-Phe-Gly-CH2-O-CH2-Gly-CH2-O-CH2-Cbz
HY-49463 1 Each

Fmoc-Gly-Gly-Phe-Gly-CH2-O-CH2-Gly-CH2-O-CH2-Cbz

Sign In for Pricing
View Details
PLV3-U6-ZBP1-shRNA3-Puro Plasmid
PVT77761 2 µg

PLV3-U6-ZBP1-shRNA3-Puro Plasmid

Sign In for Pricing
View Details
53BP1 (Ab-29)
303925 100 µL

53BP1 (Ab-29)

Sign In for Pricing
View Details
Tyrosine Hydroxylase (LNC1) Recombinant Chicken Chimeric mAb Antibody
orb3167130 20 ul

Tyrosine Hydroxylase (LNC1) Recombinant Chicken Chimeric mAb Antibody

Sign In for Pricing
View Details
FXN (Frataxin, Mitochondrial, Friedreich Ataxia Protein, Frataxin Intermediate Form, Frataxin (56-210), Frataxin (81-210), FRDA, X25) (Biotin)
127034-Biotin 100 µL

FXN (Frataxin, Mitochondrial, Friedreich Ataxia Protein, Frataxin Intermediate Form, Frataxin (56-210), Frataxin (81-210), FRDA, X25) (Biotin)

Sign In for Pricing
View Details
SFTPD (Surfactant Protein D, COLEC7, PSP-D, SFTP4, SP-D) (PE)
MBS6185050-01 0.1 mL

SFTPD (Surfactant Protein D, COLEC7, PSP-D, SFTP4, SP-D) (PE)

Sign In for Pricing
View Details