Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EBNA2 protein

This Human EBNA2 protein spans the amino acid sequence from region 247-454aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EBNA2, BYRF1Epstein-Barr nuclear antigen 2, EBNA-2, EBV nuclear antigen 2

UniProt

Q69022

Expression Region

247-454aa

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)

Field of Research

Epigenetics, Infectious Diseases, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SYSIPSMTLSPEPLPPPAAPAHPLPGVIYDQQALPPTPGPPWWPPVRDPTPTTQTPPTNTKQGPDQGQGRGRWRGRGRSKGRGRMHKLPEPRRPGPDTSSPSMPQLSPVVSLHQGQGPENSPTPGPSTAGPVCRVTPSATPDISPIHEPESSDSEEPPFLFPSDWYPPTLEPAELDESWEGIFETTESHSSDEENVGGPSKRPRTSTQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMC8, NT (TMC8, EVER2, EVIN2, Transmembrane channel-like protein 8, Epidermodysplasia verruciformis protein 2) (MaxLight 490) discontinued
042913-ML490 100 µL

TMC8, NT (TMC8, EVER2, EVIN2, Transmembrane channel-like protein 8, Epidermodysplasia verruciformis protein 2) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Lentiviral human PPIAL4G shRNA (UAS) - Lentiviral human PPIAL4G shRNA (UAS, RFP) (25)
GTR15334646 1 Vial

Lentiviral human PPIAL4G shRNA (UAS) - Lentiviral human PPIAL4G shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
TMEM151B siRNA (Mouse)
CRN1692-01 15 nmol

TMEM151B siRNA (Mouse)

Sign In for Pricing
View Details
TMEM151B siRNA (Mouse)
CRN1692-02 30 nmol

TMEM151B siRNA (Mouse)

Sign In for Pricing
View Details
OR2B2 Antibody
DF5066-01 100 µL

OR2B2 Antibody

Sign In for Pricing
View Details
OR2B2 Antibody
DF5066-02 200 µL

OR2B2 Antibody

Sign In for Pricing
View Details