Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EBNA2 protein

This Human EBNA2 protein spans the amino acid sequence from region 247-454aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EBNA2, BYRF1Epstein-Barr nuclear antigen 2, EBNA-2, EBV nuclear antigen 2

UniProt

Q69022

Expression Region

247-454aa

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)

Field of Research

Epigenetics, Infectious Diseases, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SYSIPSMTLSPEPLPPPAAPAHPLPGVIYDQQALPPTPGPPWWPPVRDPTPTTQTPPTNTKQGPDQGQGRGRWRGRGRSKGRGRMHKLPEPRRPGPDTSSPSMPQLSPVVSLHQGQGPENSPTPGPSTAGPVCRVTPSATPDISPIHEPESSDSEEPPFLFPSDWYPPTLEPAELDESWEGIFETTESHSSDEENVGGPSKRPRTSTQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Triton X-100 Lysis Buffer with Glycerol 2X, pH 7.4
42020399-2 250 mL

Triton X-100 Lysis Buffer with Glycerol 2X, pH 7.4

Sign In for Pricing
View Details
SLC9A4 CRISPR Knock Out 293T Cell Line (Human)
44302141 1x 10^6 Cells / 1.0 mL

SLC9A4 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Human MANF Recombinant Protein Lyophilized 5UG
IHUMANFRLY5UG 5 µg

Human MANF Recombinant Protein Lyophilized 5UG

Sign In for Pricing
View Details
Mettl17 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3839908 1.0 µg DNA

Mettl17 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Cat T-Complex Protein 1 Subunit Delta (CCT4) ELISA Kit
MBS9933226 Inquire

Cat T-Complex Protein 1 Subunit Delta (CCT4) ELISA Kit

Sign In for Pricing
View Details
Recombinant Eleusine indica Tubulin alpha-2 chain (TUBA2)
MBS1146308-01 0.02 mg (E-Coli)

Recombinant Eleusine indica Tubulin alpha-2 chain (TUBA2)

Sign In for Pricing
View Details