Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial ENTH protein

This Bacterial ENTH protein spans the amino acid sequence from region 25-241aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SEH

UniProt

P0A0M0

Expression Region

25-241aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Staphylococcus aureus

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 25-241aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKKKV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PGC/Gastricsin Protein, C-His
HB758022-01 50 µg

Recombinant Human PGC/Gastricsin Protein, C-His

Sign In for Pricing
View Details
Recombinant Human PGC/Gastricsin Protein, C-His
HB758022-02 100 µg

Recombinant Human PGC/Gastricsin Protein, C-His

Sign In for Pricing
View Details
Recombinant Human PGC/Gastricsin Protein, C-His
HB758022-03 1 mg

Recombinant Human PGC/Gastricsin Protein, C-His

Sign In for Pricing
View Details
Rabbit Polyclonal SP-B/Surfactant Protein B Antibody
NBP3-11280 50 µg

Rabbit Polyclonal SP-B/Surfactant Protein B Antibody

Sign In for Pricing
View Details
SS18L1 CRISPR Knock Out 293T Cell Line (Human)
45529141 1x 10^6 Cells / 1.0 mL

SS18L1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
EIF3D Antibody; FITC conjugated
MBS7006792-01 0.05 mg

EIF3D Antibody; FITC conjugated

Sign In for Pricing
View Details