Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial ENTH protein

This Bacterial ENTH protein spans the amino acid sequence from region 25-241aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SEH

UniProt

P0A0M0

Expression Region

25-241aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Staphylococcus aureus

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 25-241aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKKKV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cerdulatinib (PRT2070)
TRC-C273000-25MG 25 mg

Cerdulatinib (PRT2070)

Sign In for Pricing
View Details
Sp-Cyclic AMPS (sodium salt)
MBS5802240 Inquire

Sp-Cyclic AMPS (sodium salt)

Sign In for Pricing
View Details
CD49d (Antigen CD49d, CD49d Antigen, CDw49d, Alpha 4 Subunit of VLA-4 Receptor, Integrin alpha IV, Integrin alpha 4, IA4, ITGA4, LPAM23, MGC90518, Very Late Activation Protein 4 Receptor Alpha 4 Subunit, VLA4, VLA-4) (APC)
C2404-46J-APC 100 µL

CD49d (Antigen CD49d, CD49d Antigen, CDw49d, Alpha 4 Subunit of VLA-4 Receptor, Integrin alpha IV, Integrin alpha 4, IA4, ITGA4, LPAM23, MGC90518, Very Late Activation Protein 4 Receptor Alpha 4 Subunit, VLA4, VLA-4) (APC)

Sign In for Pricing
View Details
Mouse Monoclonal Ephrin-A4 Antibody (MM0263-9H13) [DyLight 650]
NBP2-12280C 0.1 mL

Mouse Monoclonal Ephrin-A4 Antibody (MM0263-9H13) [DyLight 650]

Sign In for Pricing
View Details
Human PRSS41 knockdown cell line
ABC-KD12274 1 Vial

Human PRSS41 knockdown cell line

Sign In for Pricing
View Details
POPDC3 293 Cell Lysate
405835 0.1 mg

POPDC3 293 Cell Lysate

Sign In for Pricing
View Details