Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial ENTH protein

This Bacterial ENTH protein spans the amino acid sequence from region 25-241aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SEH

UniProt

P0A0M0

Expression Region

25-241aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Staphylococcus aureus

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-taggedExpression Region: 25-241aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKKKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FGF6 Protein
E40KMPH3239 20 µg

Human FGF6 Protein

Sign In for Pricing
View Details
His-Tag, CT (Polyhistidine Tag)
361639 200 µg

His-Tag, CT (Polyhistidine Tag)

Sign In for Pricing
View Details
Mouse Tether containing UBX domain for GLUT4, Aspscr1 ELISA KIT
ELI-11275m 96 Tests

Mouse Tether containing UBX domain for GLUT4, Aspscr1 ELISA KIT

Sign In for Pricing
View Details
Recombinant Human PPP1R14A Protein, His Tag
KMH1587-01 100 µg

Recombinant Human PPP1R14A Protein, His Tag

Sign In for Pricing
View Details
Recombinant Human PPP1R14A Protein, His Tag
KMH1587-02 50 µg

Recombinant Human PPP1R14A Protein, His Tag

Sign In for Pricing
View Details
ADIPOQ CRISPR Knock Out 293T Cell Line (Human)
11424141 1x 10^6 Cells / 1.0 mL

ADIPOQ CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details