Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial ENTH protein

This Bacterial ENTH protein spans the amino acid sequence from region 25-241aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SEH

UniProt

P0A0M0

Expression Region

25-241aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Staphylococcus aureus

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-taggedExpression Region: 25-241aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKKKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CD27L (N-10His)
32-11111-10 10 µg

Recombinant Mouse CD27L (N-10His)

Sign In for Pricing
View Details
PARP16 Antibody
orb1325458-01 30 µL

PARP16 Antibody

Sign In for Pricing
View Details
PARP16 Antibody
orb1325458-02 50 μL

PARP16 Antibody

Sign In for Pricing
View Details
PARP16 Antibody
orb1325458-03 100 µL

PARP16 Antibody

Sign In for Pricing
View Details
Human FBLIM1 Pre-designed siRNA Set B
SI005501B 1 Each

Human FBLIM1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
MMP27, CT (Matrix Metalloproteinase-27, MMP-27, UNQ2503/PRO5992) discontinued
M2438-17A 50 µg

MMP27, CT (Matrix Metalloproteinase-27, MMP-27, UNQ2503/PRO5992) discontinued

Sign In for Pricing
View Details