Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial ENTH protein

This Bacterial ENTH protein spans the amino acid sequence from region 25-241aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SEH

UniProt

P0A0M0

Expression Region

25-241aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Staphylococcus aureus

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-taggedExpression Region: 25-241aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKKKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Btbd9 sgRNA CRISPR Lentivector set (Mouse)
K4893301 3x 1.0 µg

Btbd9 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Rbm11 3'UTR Lenti-reporter-Luc Vector
38594084 1.0 µg

Rbm11 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Mmu-miR-467a-3p miRNA Inhibitor
CIM0228-01 10 nmol

Mmu-miR-467a-3p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-467a-3p miRNA Inhibitor
CIM0228-02 20 nmol

Mmu-miR-467a-3p miRNA Inhibitor

Sign In for Pricing
View Details
OPN3 antibody
MBS5302881-01 0.1 mL

OPN3 antibody

Sign In for Pricing
View Details
OPN3 antibody
MBS5302881-02 5x 0.1 mL

OPN3 antibody

Sign In for Pricing
View Details