What is the catalog number for Bacterial CLFA protein?

The catalog number for Bacterial CLFA protein is orb418846.

What sizes are available for Bacterial CLFA protein?

Bacterial CLFA protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Bacterial CLFA protein come in?

Bacterial CLFA protein is available in 3 different pack sizes.

Is Bacterial CLFA protein in stock?

Bacterial CLFA protein is currently made to order / not held in immediate stock. Contact us for lead time.

Bacterial CLFA protein

This Bacterial CLFA protein spans the amino acid sequence from region 229-559aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibrinogen receptor A Fibrinogen-binding protein A

UniProt

Q5HHM8

Expression Region

229-559aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Staphylococcus aureus (strain COL)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-taggedExpression Region: 229-559aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE