Pig GPX5 protein
This Pig GPX5 protein spans the amino acid sequence from region 22-219aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Epididymis-specific glutathione peroxidase-like protein Short name, EGLP Glutathione peroxidase 5 Short name, GPx-5 Short name, GSHPx-
UniProt
O18994
Expression Region
22-219aa
Tag
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Sus scrofa (Pig)
Field of Research
Neuroscience; Metabolism Research
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
42.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 22-219aaSequence Info: Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
NSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQYAGKHVLFVNVATYCGLTAQYPELNTLQEELKPFGLVVLGFPCNQFGKQEPGENSEILLGLKYVRPGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELIGSIGYISWEPIRVHDIRWNFEKFLVGPDGVPVMRWVHETPISTVKSDILAYLKQFKTE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
QP10493-HIS-1mg 1mg
Recombinant Human Bcl 2 (minus BH3 domain) Protein, His, E.coli-1mg
Sign In for Pricing
View Details 
12954126 3x 1.0µg DNA
B4GALT3 CRISPRa sgRNA lentivector (set of three targets)(Rat)
Sign In for Pricing
View Details A2295-23D-ML750 100 µL
Annexin II (ANX2, Annexin A2, ANXA2, ANX2L4, Calpactin 1 Heavy Chain, Calpactin I Heavy Polypeptide (p36), CAL1H, Chromobindin 8, Lipocortin 2, Lipocortin II, LIP2, LPC2, LPC2D, p36, Placental Anticoagulant Protein IV, PAP-IV) (MaxLight 750) discontinued
Sign In for Pricing
View Details 