Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pig GPX5 protein

This Pig GPX5 protein spans the amino acid sequence from region 22-219aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Epididymis-specific glutathione peroxidase-like protein Short name, EGLP Glutathione peroxidase 5 Short name, GPx-5 Short name, GSHPx-

UniProt

O18994

Expression Region

22-219aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 22-219aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQYAGKHVLFVNVATYCGLTAQYPELNTLQEELKPFGLVVLGFPCNQFGKQEPGENSEILLGLKYVRPGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELIGSIGYISWEPIRVHDIRWNFEKFLVGPDGVPVMRWVHETPISTVKSDILAYLKQFKTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Annexin V (ANX-V) antibody (IgG) ELISA Kit
GTR10475237 96 Well

Mouse Annexin V (ANX-V) antibody (IgG) ELISA Kit

Sign In for Pricing
View Details
Cynomolgus / Rhesus macaque CD19 (20-292) Protein, Fc Tag (MALS & SPR verified)
CD9-C5354-100ug 100 µg

Cynomolgus / Rhesus macaque CD19 (20-292) Protein, Fc Tag (MALS & SPR verified)

Sign In for Pricing
View Details
Rat Pyruvate Kinase A ELISA Kit
MBS721093-01 48 Well

Rat Pyruvate Kinase A ELISA Kit

Sign In for Pricing
View Details
Rat Pyruvate Kinase A ELISA Kit
MBS721093-02 96 Well

Rat Pyruvate Kinase A ELISA Kit

Sign In for Pricing
View Details
Rat Pyruvate Kinase A ELISA Kit
MBS721093-03 5x 96 Well

Rat Pyruvate Kinase A ELISA Kit

Sign In for Pricing
View Details
Rat Pyruvate Kinase A ELISA Kit
MBS721093-04 10x 96 Well

Rat Pyruvate Kinase A ELISA Kit

Sign In for Pricing
View Details