Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse BAS1 protein

This Mouse BAS1 protein spans the amino acid sequence from region 66-266aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thiol-specific antioxidant protein A

UniProt

Q96291

Expression Region

66-266aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 66-266aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC3, CT (HDAC3, Histone deacetylase 3, RPD3-2, SMAP45) (Biotin) discontinued
036478-Biotin 200 µL

HDAC3, CT (HDAC3, Histone deacetylase 3, RPD3-2, SMAP45) (Biotin) discontinued

Sign In for Pricing
View Details
CN045 rabbit pAb
RA31703-01 50 µL

CN045 rabbit pAb

Sign In for Pricing
View Details
CN045 rabbit pAb
RA31703-02 100 µL

CN045 rabbit pAb

Sign In for Pricing
View Details
Select Ultra Tissue Grinder 50ml Conical - PK10
SLS1362 10 / PCK

Select Ultra Tissue Grinder 50ml Conical - PK10

Sign In for Pricing
View Details
ATG5 Antibody; Biotin conjugated
MBS7004893-01 0.05 mg

ATG5 Antibody; Biotin conjugated

Sign In for Pricing
View Details
ATG5 Antibody; Biotin conjugated
MBS7004893-02 0.1 mg

ATG5 Antibody; Biotin conjugated

Sign In for Pricing
View Details