Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse BAS1 protein

This Mouse BAS1 protein spans the amino acid sequence from region 66-266aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thiol-specific antioxidant protein A

UniProt

Q96291

Expression Region

66-266aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 66-266aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4930538K18Rik 3'UTR GFP Stable Cell Line
TU150741 1.0 mL

4930538K18Rik 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
AI661453 3'UTR GFP Stable Cell Line
TU151573 1.0 mL

AI661453 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rabbit Polyclonal LYPD6 Antibody
NBP2-98014-50ul 50 µL

Rabbit Polyclonal LYPD6 Antibody

Sign In for Pricing
View Details
Gpr182 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6854103 1.0 µg DNA

Gpr182 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Albumin ELISA Kit (Pig)
OKIA00185-96W 1x 96 Well Plate

Albumin ELISA Kit (Pig)

Sign In for Pricing
View Details
Gm1078 Protein Vector (Mouse) (pPM-C-His)
PV182633 500 ng

Gm1078 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details