Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse BAS1 protein

This Mouse BAS1 protein spans the amino acid sequence from region 66-266aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thiol-specific antioxidant protein A

UniProt

Q96291

Expression Region

66-266aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 66-266aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDHB Knockout Cell Line-A549
RK-0533 1x 10^6

SDHB Knockout Cell Line-A549

Sign In for Pricing
View Details
ZDHHC4 Human Over-expression Lysate
orb1340883 100 µg

ZDHHC4 Human Over-expression Lysate

Sign In for Pricing
View Details
Human S-acyl fatty acid synthase thioesterase, medium chain (OLAH) ELISA Kit
CK-bio-24857-01 48 Tests

Human S-acyl fatty acid synthase thioesterase, medium chain (OLAH) ELISA Kit

Sign In for Pricing
View Details
Human S-acyl fatty acid synthase thioesterase, medium chain (OLAH) ELISA Kit
CK-bio-24857-02 96 Tests

Human S-acyl fatty acid synthase thioesterase, medium chain (OLAH) ELISA Kit

Sign In for Pricing
View Details
Corn oil
T5137-01 50 mL

Corn oil

Sign In for Pricing
View Details
Corn oil
T5137-02 100 mL

Corn oil

Sign In for Pricing
View Details