Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli FIMH protein

This E. coli FIMH protein spans the amino acid sequence from region 22-300aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FimH, b4320, JW4283Type 1 fimbrin D-mannose specific adhesin, Protein FimH

UniProt

P08191

Expression Region

22-300aa

Tag

Tag-Free

Source

Yeast

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 22-300aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BEN Domain Containing Protein 5 (BEND5) (C-term) Goat Polyclonal Antibody
AP32947PU-N 100 µg

BEN Domain Containing Protein 5 (BEND5) (C-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
4-Fluorophenyl-5’-oxobutyric Acid
TRC-F588495-1G 1 g

4-Fluorophenyl-5’-oxobutyric Acid

Sign In for Pricing
View Details
PIKFYVE Antibody
KC-1527-01 50 μL

PIKFYVE Antibody

Sign In for Pricing
View Details
PIKFYVE Antibody
KC-1527-02 100 µL

PIKFYVE Antibody

Sign In for Pricing
View Details
PIKFYVE Antibody
KC-1527-03 1 mL

PIKFYVE Antibody

Sign In for Pricing
View Details
ReadiUse™ TMB Substrate Solution *Optimized for ELISA Assays with HRP Conjugates*
11012-AAT 100 mL

ReadiUse™ TMB Substrate Solution *Optimized for ELISA Assays with HRP Conjugates*

Sign In for Pricing
View Details