What is the catalog number for Bacterial Angiotensinogen protein?

The catalog number for Bacterial Angiotensinogen protein is orb418827.

What sizes are available for Bacterial Angiotensinogen protein?

Bacterial Angiotensinogen protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Bacterial Angiotensinogen protein come in?

Bacterial Angiotensinogen protein is available in 3 different pack sizes.

Is Bacterial Angiotensinogen protein in stock?

Bacterial Angiotensinogen protein is currently made to order / not held in immediate stock. Contact us for lead time.

Bacterial Angiotensinogen protein

This Bacterial Angiotensinogen protein spans the amino acid sequence from region 1-183aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PPT N-acetyltransferase, Phosphinothricin-resistance protein

UniProt

Q57146

Expression Region

1-183aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Streptomyces viridochromogenes

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-183aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSPERRPVEIRPATAADMAAVCDIVNHYIETSTVNFRTEPQTPQEWIDDLERLQDRYPWLVAEVEGVVAGIAYAGPWKARNAYDWTVESTVYVSHRHQRLGLGSTLYTHLLKSMEAQGFKSVVAVIGLPNDPSVRLHEALGYTARGTLRAAGYKHGGWHDVGFWQRDFELPAPPRPVRPVTQI