Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial Angiotensinogen protein

This Bacterial Angiotensinogen protein spans the amino acid sequence from region 1-183aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PPT N-acetyltransferase, Phosphinothricin-resistance protein

UniProt

Q57146

Expression Region

1-183aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Streptomyces viridochromogenes

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-183aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSPERRPVEIRPATAADMAAVCDIVNHYIETSTVNFRTEPQTPQEWIDDLERLQDRYPWLVAEVEGVVAGIAYAGPWKARNAYDWTVESTVYVSHRHQRLGLGSTLYTHLLKSMEAQGFKSVVAVIGLPNDPSVRLHEALGYTARGTLRAAGYKHGGWHDVGFWQRDFELPAPPRPVRPVTQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNHIT3 (NM_001281433) Human Untagged Clone
SC333397 10 µg

ZNHIT3 (NM_001281433) Human Untagged Clone

Sign In for Pricing
View Details
TEX28P1 sgRNA CRISPR Lentivector (Human) (Target 3)
K2360104 1.0 µg DNA

TEX28P1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
(E) -Dodeca-9,11-dien-1-yl acetate
OR1062030-01 100 mg

(E) -Dodeca-9,11-dien-1-yl acetate

Sign In for Pricing
View Details
(E) -Dodeca-9,11-dien-1-yl acetate
OR1062030-02 250 mg

(E) -Dodeca-9,11-dien-1-yl acetate

Sign In for Pricing
View Details
Human Non POU Domain Containing Octamer Binding Protein (NONO) ELISA Kit
BSKH63945-01 48 Tests

Human Non POU Domain Containing Octamer Binding Protein (NONO) ELISA Kit

Sign In for Pricing
View Details
Human Non POU Domain Containing Octamer Binding Protein (NONO) ELISA Kit
BSKH63945-02 96 Tests

Human Non POU Domain Containing Octamer Binding Protein (NONO) ELISA Kit

Sign In for Pricing
View Details